SCOPe 2.03: Domain d2o39a1: 2o39 A:129-325

Lineage for d2o39a1 (2o39 A:129-325)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein "knob" domain [49837] (8 species)

7. Species Human adenovirus type 11P [TaxId:343462] [158980] (1 PDB entry)
   Uniprot P35774 129-325

8. Domain d2o39a1: 2o39 A:129-325 [145712]
   Other proteins in same PDB: d2o39c1, d2o39c2, d2o39d1, d2o39d2
   complexed with ca

Details for d2o39a1

PDB Entry: 2o39, 2.85 Å

PDB Description: human adenovirus type 11 knob in complex with domains scr1 and scr2 of cd46 (membrane cofactor protein, mcp)

PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d2o39a1:

Sequence; same for both SEQRES and ATOM records:

>d2o39a1 b.21.1.1 (A:129-325) Adenovirus fiber protein "knob" domain {Human adenovirus type 11P [TaxId: 343462]}
dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth
rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns
rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa
ttlvtspftfyyiredd

Timeline for d2o39a1:

• d2o39a1 first appeared in SCOP 1.75
  
• d2o39a1 appears in SCOPe 2.02
  
• d2o39a1 appears in SCOPe 2.04
  
• d2o39a1 appears in the current release, SCOPe 2.08