![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein Hypothetical protein VC0737 [143140] (1 species) Putative acetoin utilization protein AcuB |
![]() | Species Vibrio cholerae [TaxId:666] [143141] (1 PDB entry) Uniprot Q9KTZ3 21-83! Uniprot Q9KTZ3 93-159 |
![]() | Domain d2o16b3: 2o16 B:20-158 [145711] Other proteins in same PDB: d2o16a4, d2o16b4 complexed with po4 |
PDB Entry: 2o16 (more details), 1.9 Å
SCOPe Domain Sequences for d2o16b3:
Sequence, based on SEQRES records: (download)
>d2o16b3 d.37.1.1 (B:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} mikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaaqes slqrsaqgdslafetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvgi itdsdfvtiainllelqee
>d2o16b3 d.37.1.1 (B:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} mikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaaqes sslafetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvgiitdsdfvt iainllelqee
Timeline for d2o16b3: