Lineage for d2o16a3 (2o16 A:20-158)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167407Family d.37.1.1: CBS-domain pair [54632] (21 protein domains)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2167453Protein Hypothetical protein VC0737 [143140] (1 species)
    Putative acetoin utilization protein AcuB
  7. 2167454Species Vibrio cholerae [TaxId:666] [143141] (1 PDB entry)
    Uniprot Q9KTZ3 21-83! Uniprot Q9KTZ3 93-159
  8. 2167455Domain d2o16a3: 2o16 A:20-158 [145710]
    Other proteins in same PDB: d2o16a4, d2o16b4
    complexed with po4

Details for d2o16a3

PDB Entry: 2o16 (more details), 1.9 Å

PDB Description: crystal structure of a putative acetoin utilization protein (acub) from vibrio cholerae
PDB Compounds: (A:) Acetoin utilization protein AcuB, putative

SCOPe Domain Sequences for d2o16a3:

Sequence, based on SEQRES records: (download)

>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]}
mikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaaqes
slqrsaqgdslafetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvgi
itdsdfvtiainllelqee

Sequence, based on observed residues (ATOM records): (download)

>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]}
mikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaaqes
slqfetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvgiitdsdfvti
ainllelqee

SCOPe Domain Coordinates for d2o16a3:

Click to download the PDB-style file with coordinates for d2o16a3.
(The format of our PDB-style files is described here.)

Timeline for d2o16a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o16a4