SCOPe 2.08: Domain d2o16a3: 2o16 A:20-158

Lineage for d2o16a3 (2o16 A:20-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Hypothetical protein VC0737 [143140] (1 species)
   Putative acetoin utilization protein AcuB

7. Species Vibrio cholerae [TaxId:666] [143141] (1 PDB entry)
   Uniprot Q9KTZ3 21-83! Uniprot Q9KTZ3 93-159

8. Domain d2o16a3: 2o16 A:20-158 [145710]
   Other proteins in same PDB: d2o16a4, d2o16b4
   complexed with po4

Details for d2o16a3

PDB Entry: 2o16, 1.9 Å

PDB Description: crystal structure of a putative acetoin utilization protein (acub) from vibrio cholerae

PDB Compounds: (A:) Acetoin utilization protein AcuB, putative

SCOPe Domain Sequences for d2o16a3:

Sequence, based on SEQRES records:

>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]}
mikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaaqes
slqrsaqgdslafetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvgi
itdsdfvtiainllelqee

Sequence, based on observed residues (ATOM records):

>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]}
mikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivsqrdllaaqes
slqfetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvgiitdsdfvti
ainllelqee

Timeline for d2o16a3:

• d2o16a3 first appeared in SCOP 1.75
  
• d2o16a3 appears in SCOPe 2.07