Lineage for d2ny7g_ (2ny7 G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1443695Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1443696Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1443697Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1443723Protein automated matches [190166] (2 species)
    not a true protein
  7. 1443724Species Human immunodeficiency virus 1 [TaxId:11676] [186893] (3 PDB entries)
  8. 1443727Domain d2ny7g_: 2ny7 G: [145709]
    Other proteins in same PDB: d2ny7h1, d2ny7h2, d2ny7l1, d2ny7l2
    automated match to d1g9mg_
    complexed with nag

Details for d2ny7g_

PDB Entry: 2ny7 (more details), 2.3 Å

PDB Description: hiv-1 gp120 envelope glycoprotein complexed with the broadly neutralizing cd4-binding-site antibody b12
PDB Compounds: (G:) envelope glycoprotein gp120

SCOPe Domain Sequences for d2ny7g_:

Sequence, based on SEQRES records: (download)

>d2ny7g_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwckvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d2ny7g_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhedicslwdqslkpcvacpkvsfepipihycapagfai
lkcnnktfngtgpctnvstvqcthgirpvvssqlllngslaeeevvirscnftdnaktii
vqlntsveinctgaghcniarakwnntlkqiasklreqfgnnktiifkqssggdpeivth
wfncggeffycnstqlfnstwfnstwsgsdtitlpcrikqiinmwckvgkmmyappisgq
ircssnitgllltrdggnsnneseifrpgggdmrdnwrselykykvvkie

SCOPe Domain Coordinates for d2ny7g_:

Click to download the PDB-style file with coordinates for d2ny7g_.
(The format of our PDB-style files is described here.)

Timeline for d2ny7g_: