Lineage for d2ny5g1 (2ny5 G:83-491)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560277Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 2560278Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 2560279Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 2560280Protein gp120 core [56504] (3 species)
  7. 2560283Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 2560297Domain d2ny5g1: 2ny5 G:83-491 [145707]
    Other proteins in same PDB: d2ny5c1, d2ny5c2, d2ny5h1, d2ny5h2, d2ny5l1, d2ny5l2
    complexed with nag, suc

Details for d2ny5g1

PDB Entry: 2ny5 (more details), 2.5 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t257s, v275c, s334a, s375w, q428c, a433m) complexed with cd4 and antibody 17b
PDB Compounds: (G:) envelope glycoprotein gp120

SCOPe Domain Sequences for d2ny5g1:

Sequence, based on SEQRES records: (download)

>d2ny5g1 d.172.1.1 (G:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwckvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvki

Sequence, based on observed residues (ATOM records): (download)

>d2ny5g1 d.172.1.1 (G:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfngsdtitlpcrikqiinmw
ckvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselykyk
vvki

SCOPe Domain Coordinates for d2ny5g1:

Click to download the PDB-style file with coordinates for d2ny5g1.
(The format of our PDB-style files is described here.)

Timeline for d2ny5g1: