Lineage for d2ny4a1 (2ny4 A:83-491)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941821Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1941822Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1941823Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1941824Protein gp120 core [56504] (2 species)
  7. 1941825Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 1941828Domain d2ny4a1: 2ny4 A:83-491 [145706]
    Other proteins in same PDB: d2ny4b1, d2ny4b2, d2ny4c1, d2ny4c2, d2ny4d1, d2ny4d2
    complexed with hez, nag, suc

Details for d2ny4a1

PDB Entry: 2ny4 (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (k231c, t257s, e268c, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (A:) envelope glycoprotein gp120

SCOPe Domain Sequences for d2ny4a1:

Sequence, based on SEQRES records: (download)

>d2ny4a1 d.172.1.1 (A:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnmwkndmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnctfngtgpctnvstvqcthgirpvvssqlllngsla
ecevvirsvnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwqkvgkamyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvki

Sequence, based on observed residues (ATOM records): (download)

>d2ny4a1 d.172.1.1 (A:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnmwkndmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnctfngtgpctnvstvqcthgirpvvssqlllngsla
ecevvirsvnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstgsdtitlpcrikqiin
mwqkvgkamyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselyk
ykvvki

SCOPe Domain Coordinates for d2ny4a1:

Click to download the PDB-style file with coordinates for d2ny4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ny4a1: