Lineage for d2ny1a1 (2ny1 A:83-492)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560277Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 2560278Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 2560279Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 2560280Protein gp120 core [56504] (3 species)
  7. 2560283Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 2560289Domain d2ny1a1: 2ny1 A:83-492 [145703]
    Other proteins in same PDB: d2ny1b1, d2ny1b2, d2ny1c1, d2ny1c2, d2ny1d1, d2ny1d2
    complexed with nag, suc

Details for d2ny1a1

PDB Entry: 2ny1 (more details), 1.99 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (i109c, t257s, s334a, s375w, q428c) complexed with cd4 and antibody 17b
PDB Compounds: (A:) envelope glycoprotein gp120

SCOPe Domain Sequences for d2ny1a1:

Sequence, based on SEQRES records: (download)

>d2ny1a1 d.172.1.1 (A:83-492) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnmwkndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirsvnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwckvgkamyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d2ny1a1 d.172.1.1 (A:83-492) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnmwkndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirsvnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfngsdtitlpcrikqiinmw
ckvgkamyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselykyk
vvkie

SCOPe Domain Coordinates for d2ny1a1:

Click to download the PDB-style file with coordinates for d2ny1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ny1a1: