Lineage for d2nxza1 (2nxz A:83-491)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683292Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1683293Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1683294Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1683295Protein gp120 core [56504] (2 species)
  7. 1683296Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 1683302Domain d2nxza1: 2nxz A:83-491 [145702]
    Other proteins in same PDB: d2nxzb1, d2nxzb2, d2nxzc1, d2nxzc2, d2nxzd1, d2nxzd2
    complexed with edo, hez, ipa, nag, suc

Details for d2nxza1

PDB Entry: 2nxz (more details), 2.04 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t257s, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (A:) envelope glycoprotein gp120

SCOPe Domain Sequences for d2nxza1:

Sequence, based on SEQRES records: (download)

>d2nxza1 d.172.1.1 (A:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnmwkndmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirsvnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwqkvgkamyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvki

Sequence, based on observed residues (ATOM records): (download)

>d2nxza1 d.172.1.1 (A:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnmwkndmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirsvnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstgsdtitlpcrikqiin
mwqkvgkamyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselyk
ykvvki

SCOPe Domain Coordinates for d2nxza1:

Click to download the PDB-style file with coordinates for d2nxza1.
(The format of our PDB-style files is described here.)

Timeline for d2nxza1: