Lineage for d2nxnb2 (2nxn B:2-68)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553569Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2553570Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2553571Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2553575Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2553614Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
    Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70
  8. 2553626Domain d2nxnb2: 2nxn B:2-68 [145700]
    Other proteins in same PDB: d2nxna1, d2nxnb1
    automatically matched to 2HGJ L:2-68

Details for d2nxnb2

PDB Entry: 2nxn (more details), 2.4 Å

PDB Description: t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11
PDB Compounds: (B:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2nxnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxnb2 d.47.1.1 (B:2-68) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfv

SCOPe Domain Coordinates for d2nxnb2:

Click to download the PDB-style file with coordinates for d2nxnb2.
(The format of our PDB-style files is described here.)

Timeline for d2nxnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nxnb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2nxna1