| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
| Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (2 PDB entries) Uniprot P61081 27-183 the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F |
| Domain d2nvuc1: 2nvu C:3-183 [145698] Other proteins in same PDB: d2nvua_, d2nvub1, d2nvub2, d2nvui_, d2nvuj_ complexed with atp, mg, zn |
PDB Entry: 2nvu (more details), 2.8 Å
SCOPe Domain Sequences for d2nvuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvuc1 d.20.1.1 (C:3-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
klfslkqqkkeeekgsskkasaaqlriqkdinelnlpktcdisfsdpddllnfklvicpd
egfyksgkfvfsfkvgqgyphdppkvkcetmvyhpnidlegnvalnilredwkpvltins
iiyglqylflepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyferclk
Timeline for d2nvuc1: