SCOP 1.75: Domain d2nvuc1: 2nvu C:3-183

Lineage for d2nvuc1 (2nvu C:3-183)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species)

7. Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (2 PDB entries)
   Uniprot P61081 27-183
   the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F

8. Domain d2nvuc1: 2nvu C:3-183 [145698]
   Other proteins in same PDB: d2nvua1, d2nvub1, d2nvub2, d2nvui1, d2nvuj1
   complexed with atp, mg, zn; mutant

Details for d2nvuc1

PDB Entry: 2nvu, 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex

PDB Compounds: (C:) NEDD8-conjugating enzyme Ubc12

SCOP Domain Sequences for d2nvuc1:

Sequence; same for both SEQRES and ATOM records:

>d2nvuc1 d.20.1.1 (C:3-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
klfslkqqkkeeekgsskkasaaqlriqkdinelnlpktcdisfsdpddllnfklvicpd
egfyksgkfvfsfkvgqgyphdppkvkcetmvyhpnidlegnvalnilredwkpvltins
iiyglqylflepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyferclk

Timeline for d2nvuc1:

• d2nvuc1 is new in SCOP 1.75
  
• d2nvuc1 appears in SCOPe 2.01
  
• d2nvuc1 appears in the current release, SCOPe 2.08