SCOPe 2.01: Domain d2nu2i1: 2nu2 I:6-56

Lineage for d2nu2i1 (2nu2 I:6-56)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries)

8. Domain d2nu2i1: 2nu2 I:6-56 [145697]
   Other proteins in same PDB: d2nu2e_

Details for d2nu2i1

PDB Entry: 2nu2, 1.65 Å

PDB Description: accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i

PDB Compounds: (I:) Ovomucoid

SCOPe Domain Sequences for d2nu2i1:

Sequence; same for both SEQRES and ATOM records:

>d2nu2i1 g.68.1.1 (I:6-56) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactreyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Timeline for d2nu2i1:

• d2nu2i1 first appeared in SCOP 1.75
  
• d2nu2i1 appears in SCOPe 2.02
  
• d2nu2i1 appears in the current release, SCOPe 2.08