Lineage for d2nu2i1 (2nu2 I:6-56)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 3038472Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 3038484Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries)
  8. 3038487Domain d2nu2i1: 2nu2 I:6-56 [145697]
    Other proteins in same PDB: d2nu2e_

Details for d2nu2i1

PDB Entry: 2nu2 (more details), 1.65 Å

PDB Description: accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
PDB Compounds: (I:) Ovomucoid

SCOPe Domain Sequences for d2nu2i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu2i1 g.68.1.1 (I:6-56) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactreyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOPe Domain Coordinates for d2nu2i1:

Click to download the PDB-style file with coordinates for d2nu2i1.
(The format of our PDB-style files is described here.)

Timeline for d2nu2i1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nu2e_