Lineage for d2nppc1 (2npp C:6-293)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440548Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1440554Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)
  7. 1440555Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
    Uniprot P67775 2-294
  8. 1440568Domain d2nppc1: 2npp C:6-293 [145692]
    Other proteins in same PDB: d2nppa1, d2nppb1, d2nppd1, d2nppe1
    automatically matched to 2IE4 C:6-293
    complexed with mn

Details for d2nppc1

PDB Entry: 2npp (more details), 3.3 Å

PDB Description: Structure of the Protein Phosphatase 2A Holoenzyme
PDB Compounds: (C:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOPe Domain Sequences for d2nppc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nppc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
ftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfhdl
melfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqitq
vygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiraldr
lqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahqlvm
egynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap

SCOPe Domain Coordinates for d2nppc1:

Click to download the PDB-style file with coordinates for d2nppc1.
(The format of our PDB-style files is described here.)

Timeline for d2nppc1: