Lineage for d2jdib2 (2jdi B:23-94)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1547881Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1547882Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1547883Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1547884Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 1547887Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 1547889Domain d2jdib2: 2jdi B:23-94 [145687]
    Other proteins in same PDB: d2jdia1, d2jdia3, d2jdib1, d2jdib3, d2jdic1, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig_, d2jdih1, d2jdih2, d2jdii_
    automated match to d1e79a2
    complexed with anp, mg

Details for d2jdib2

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (B:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jdib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdib2 b.49.1.1 (B:23-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
vdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndkli
kegdivkrtgai

SCOPe Domain Coordinates for d2jdib2:

Click to download the PDB-style file with coordinates for d2jdib2.
(The format of our PDB-style files is described here.)

Timeline for d2jdib2: