Lineage for d2jbgd_ (2jbg D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535017Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2535018Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2535019Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 2535020Protein DNase domain of colicin E7 [54062] (1 species)
  7. 2535021Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)
  8. 2535036Domain d2jbgd_: 2jbg D: [145682]
    Other proteins in same PDB: d2jbga_, d2jbgc_
    automated match to d1mz8b_
    protein/DNA complex; complexed with so4, zn; mutant

Details for d2jbgd_

PDB Entry: 2jbg (more details), 2.2 Å

PDB Description: crystal structure of the mutant n560a of the nuclease domain of cole7 in complex with im7
PDB Compounds: (D:) colicin e7

SCOPe Domain Sequences for d2jbgd_:

Sequence, based on SEQRES records: (download)

>d2jbgd_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp
elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdaisvvtpk
rhidihrgk

Sequence, based on observed residues (ATOM records): (download)

>d2jbgd_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp
elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhevydmdaisvvtpkrhidihrg
k

SCOPe Domain Coordinates for d2jbgd_:

Click to download the PDB-style file with coordinates for d2jbgd_.
(The format of our PDB-style files is described here.)

Timeline for d2jbgd_: