![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) ![]() contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
![]() | Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins) |
![]() | Protein automated matches [190731] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187899] (1 PDB entry) |
![]() | Domain d2j9ud_: 2j9u D: [145678] Other proteins in same PDB: d2j9ua_, d2j9ub1, d2j9uc_ automated match to d2j9ub1 complexed with zn |
PDB Entry: 2j9u (more details), 2 Å
SCOPe Domain Sequences for d2j9ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ud_ g.41.11.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssinc
Timeline for d2j9ud_: