SCOP 1.75: Domain d2j9ud1: 2j9u D:115-161

Lineage for d2j9ud1 (2j9u D:115-161)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (1 family)
   contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain

5. Family g.41.11.1: Ran binding protein zinc finger-like [90210] (6 proteins)

6. Protein Vacuolar protein-sorting-associated protein 36, VPS36 [161173] (1 species)

7. Species Saccharomyces cerevisiae [TaxId:4932] [161174] (1 PDB entry)
   Uniprot Q06696 115-161

8. Domain d2j9ud1: 2j9u D:115-161 [145678]
   Other proteins in same PDB: d2j9ua1, d2j9uc1
   automatically matched to 2J9U B:115-161
   complexed with zn

Details for d2j9ud1

PDB Entry: 2j9u, 2 Å

PDB Description: 2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii

PDB Compounds: (D:) vacuolar protein sorting-associated protein 36

SCOP Domain Sequences for d2j9ud1:

Sequence; same for both SEQRES and ATOM records:

>d2j9ud1 g.41.11.1 (D:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Saccharomyces cerevisiae [TaxId: 4932]}
vstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssinc

Timeline for d2j9ud1:

• d2j9ud1 is new in SCOP 1.75
  
• d2j9ud1 is called d2j9ud_ in SCOPe 2.01
  
• d2j9ud1 appears in the current release, SCOPe 2.08, called d2j9ud_