SCOPe 2.06: Domain d2j9ub1: 2j9u B:115-161

Lineage for d2j9ub1 (2j9u B:115-161)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families)
   contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain

5. Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)

6. Protein Vacuolar protein-sorting-associated protein 36, VPS36 [161173] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161174] (1 PDB entry)
   Uniprot Q06696 115-161

8. Domain d2j9ub1: 2j9u B:115-161 [145677]
   Other proteins in same PDB: d2j9ua_, d2j9uc_, d2j9ud_
   complexed with zn

Details for d2j9ub1

PDB Entry: 2j9u, 2 Å

PDB Description: 2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii

PDB Compounds: (B:) vacuolar protein sorting-associated protein 36

SCOPe Domain Sequences for d2j9ub1:

Sequence; same for both SEQRES and ATOM records:

>d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssinc

Timeline for d2j9ub1:

• d2j9ub1 first appeared in SCOP 1.75
  
• d2j9ub1 appears in SCOPe 2.05
  
• d2j9ub1 appears in SCOPe 2.07
  
• d2j9ub1 appears in the current release, SCOPe 2.08