SCOPe 2.08: Domain d2j8xc_: 2j8x C:

Lineage for d2j8xc_ (2j8x C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Epstein-Barr virus [TaxId:10376] [159461] (1 PDB entry)
   Uniprot Q777D9 26-255

8. Domain d2j8xc_: 2j8x C: [145676]
   Other proteins in same PDB: d2j8xb_, d2j8xd_
   automated match to d2j8xa1
   protein/DNA complex; complexed with ure

Details for d2j8xc_

PDB Entry: 2j8x, 2.3 Å

PDB Description: epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2

PDB Compounds: (C:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2j8xc_:

Sequence; same for both SEQRES and ATOM records:

>d2j8xc_ c.18.1.1 (C:) Uracil-DNA glycosylase {Epstein-Barr virus [TaxId: 10376]}
nlllpdlwldflqlspifqrklaaviacvrrlrtqatvypeedmcmawarfcdpsdikvv
ilgqdpyhggqanglafsvaygfpvppslrniyaelhrslpefsppdhgcldawasqgvl
llntiltvqkgkpgshadigwawftdhvisllserlkacvfmlwgakagdkaslinskkh
lvltsqhpsplaqnstrksaqqkflgnnhfvlannflrekglgeidwrl

Timeline for d2j8xc_:

• d2j8xc_ first appeared in SCOP 1.75, called d2j8xc1
  
• d2j8xc_ appears in SCOPe 2.07