Lineage for d2j8xa1 (2j8x A:26-255)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101206Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2101207Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2101208Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 protein domains)
  6. 2101209Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2101221Species Epstein-Barr virus [TaxId:10376] [159461] (1 PDB entry)
    Uniprot Q777D9 26-255
  8. 2101222Domain d2j8xa1: 2j8x A:26-255 [145675]
    Other proteins in same PDB: d2j8xb_, d2j8xd_
    protein/DNA complex; complexed with ure

Details for d2j8xa1

PDB Entry: 2j8x (more details), 2.3 Å

PDB Description: epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2j8xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8xa1 c.18.1.1 (A:26-255) Uracil-DNA glycosylase {Epstein-Barr virus [TaxId: 10376]}
enlllpdlwldflqlspifqrklaaviacvrrlrtqatvypeedmcmawarfcdpsdikv
vilgqdpyhggqanglafsvaygfpvppslrniyaelhrslpefsppdhgcldawasqgv
lllntiltvqkgkpgshadigwawftdhvisllserlkacvfmlwgakagdkaslinskk
hlvltsqhpsplaqnstrksaqqkflgnnhfvlannflrekglgeidwrl

SCOPe Domain Coordinates for d2j8xa1:

Click to download the PDB-style file with coordinates for d2j8xa1.
(The format of our PDB-style files is described here.)

Timeline for d2j8xa1: