![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.20: M48USP-like [159852] (1 protein) Pfam PF04843; Herpesvirus tegument protein, N-terminal conserved region |
![]() | Protein Tegument protein M48; N-terminal domain [159853] (1 species) |
![]() | Species Murine cytomegalovirus (MCMV) [TaxId:10366] [159854] (1 PDB entry) Uniprot A8E1C4 1-232 |
![]() | Domain d2j7qc1: 2j7q C:1-232 [145674] Other proteins in same PDB: d2j7qb_, d2j7qd_ complexed with gol, gve, mg, pg4 |
PDB Entry: 2j7q (more details), 1.8 Å
SCOPe Domain Sequences for d2j7qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j7qc1 d.3.1.20 (C:1-232) Tegument protein M48; N-terminal domain {Murine cytomegalovirus (MCMV) [TaxId: 10366]} mkivrasrdqsapvygpragsqcmsncftflhtcylmgidpvldttsldavldsgarlda iadekvkrqaltdhpyrlgteiptvietpagitghalsrpfngtaetqdlggykclgild fltyargkplpvyiivtvgvftrgvivargatyvfdphttdlsaeaavyvcddfteaisa lsfftemigdfyydavlvyftrcrttlispsellvqimdqykdpdidasvms
Timeline for d2j7qc1: