Lineage for d2j7qc1 (2j7q C:1-232)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927518Family d.3.1.20: M48USP-like [159852] (1 protein)
    Pfam PF04843; Herpesvirus tegument protein, N-terminal conserved region
  6. 2927519Protein Tegument protein M48; N-terminal domain [159853] (1 species)
  7. 2927520Species Murine cytomegalovirus (MCMV) [TaxId:10366] [159854] (1 PDB entry)
    Uniprot A8E1C4 1-232
  8. 2927522Domain d2j7qc1: 2j7q C:1-232 [145674]
    Other proteins in same PDB: d2j7qb_, d2j7qd_
    complexed with gol, gve, mg, pg4

Details for d2j7qc1

PDB Entry: 2j7q (more details), 1.8 Å

PDB Description: crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein m48 in complex with a ubquitin-based suicide substrate
PDB Compounds: (C:) mcmv tegument protein m48 encoded ubiquitin- specific protease, m48usp

SCOPe Domain Sequences for d2j7qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7qc1 d.3.1.20 (C:1-232) Tegument protein M48; N-terminal domain {Murine cytomegalovirus (MCMV) [TaxId: 10366]}
mkivrasrdqsapvygpragsqcmsncftflhtcylmgidpvldttsldavldsgarlda
iadekvkrqaltdhpyrlgteiptvietpagitghalsrpfngtaetqdlggykclgild
fltyargkplpvyiivtvgvftrgvivargatyvfdphttdlsaeaavyvcddfteaisa
lsfftemigdfyydavlvyftrcrttlispsellvqimdqykdpdidasvms

SCOPe Domain Coordinates for d2j7qc1:

Click to download the PDB-style file with coordinates for d2j7qc1.
(The format of our PDB-style files is described here.)

Timeline for d2j7qc1: