SCOPe 2.08: Domain d2j7qa1: 2j7q A:1-232

Lineage for d2j7qa1 (2j7q A:1-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.20: M48USP-like [159852] (1 protein)
   Pfam PF04843; Herpesvirus tegument protein, N-terminal conserved region

6. Protein Tegument protein M48; N-terminal domain [159853] (1 species)

7. Species Murine cytomegalovirus (MCMV) [TaxId:10366] [159854] (1 PDB entry)
   Uniprot A8E1C4 1-232

8. Domain d2j7qa1: 2j7q A:1-232 [145673]
   Other proteins in same PDB: d2j7qb_, d2j7qd_
   complexed with gol, gve, mg, pg4

Details for d2j7qa1

PDB Entry: 2j7q, 1.8 Å

PDB Description: crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein m48 in complex with a ubquitin-based suicide substrate

PDB Compounds: (A:) mcmv tegument protein m48 encoded ubiquitin- specific protease, m48usp

SCOPe Domain Sequences for d2j7qa1:

Sequence; same for both SEQRES and ATOM records:

>d2j7qa1 d.3.1.20 (A:1-232) Tegument protein M48; N-terminal domain {Murine cytomegalovirus (MCMV) [TaxId: 10366]}
mkivrasrdqsapvygpragsqcmsncftflhtcylmgidpvldttsldavldsgarlda
iadekvkrqaltdhpyrlgteiptvietpagitghalsrpfngtaetqdlggykclgild
fltyargkplpvyiivtvgvhtrgvivargatyvfdphttdlsaeaavyvcddfteaisa
lsfftemigdfyydavlvyftrcrttlispsellvqimdqykdpdidasvms

Timeline for d2j7qa1:

• d2j7qa1 first appeared in SCOP 1.75
  
• d2j7qa1 appears in SCOPe 2.07