Lineage for d2j6em2 (2j6e M:109-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517944Domain d2j6em2: 2j6e M:109-211 [145672]
    Other proteins in same PDB: d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6el2, d2j6em1
    automated match to d2fb4l2
    complexed with act, cac, cd, mpd, zn

Details for d2j6em2

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (M:) igm

SCOPe Domain Sequences for d2j6em2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6em2 b.1.1.2 (M:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdffpgavtvawkadgapvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d2j6em2:

Click to download the PDB-style file with coordinates for d2j6em2.
(The format of our PDB-style files is described here.)

Timeline for d2j6em2: