Lineage for d2j6em2 (2j6e M:109-210)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934961Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 934965Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 935037Domain d2j6em2: 2j6e M:109-210 [145672]
    Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6em1
    automatically matched to 2J6E L:109-210
    complexed with act, cac, cd, mpd, zn

Details for d2j6em2

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (M:) igm

SCOPe Domain Sequences for d2j6em2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6em2 b.1.1.2 (M:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdffpgavtvawkadgapvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d2j6em2:

Click to download the PDB-style file with coordinates for d2j6em2.
(The format of our PDB-style files is described here.)

Timeline for d2j6em2: