Lineage for d2j6el2 (2j6e L:109-210)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2360928Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2360974Domain d2j6el2: 2j6e L:109-210 [145670]
    Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6em1, d2j6em2
    complexed with act, cac, cd, mpd, zn

Details for d2j6el2

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (L:) igm

SCOPe Domain Sequences for d2j6el2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6el2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdffpgavtvawkadgapvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d2j6el2:

Click to download the PDB-style file with coordinates for d2j6el2.
(The format of our PDB-style files is described here.)

Timeline for d2j6el2: