SCOPe 2.08: Domain d2j6ei1: 2j6e I:1-113

Lineage for d2j6ei1 (2j6e I:1-113)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

Domain d2j6ei1: 2j6e I:1-113 [145667]
Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei2, d2j6el1, d2j6el2, d2j6em1, d2j6em2
automated match to d2j6eh1
complexed with act, cac, cd, mpd, zn

Details for d2j6ei1

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation

PDB Compounds: (I:) igm

SCOPe Domain Sequences for d2j6ei1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ei1 b.1.1.1 (I:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqlqesgpglvkpsetlsltctvsggsisrgshywgwirqppgkglewigsiyysgnty
fnpslksrvtisvdtsknqfslklssvtaadtavyycarlgpddytldgmdvwgqgttvt
vss

SCOPe Domain Coordinates for d2j6ei1:

Click to download the PDB-style file with coordinates for d2j6ei1.
(The format of our PDB-style files is described here.)

Timeline for d2j6ei1: