Lineage for d2j5la1 (2j5l A:479-512)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465638Fold g.61: Apical membrane antigen 1 [82909] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 1465639Superfamily g.61.1: Apical membrane antigen 1 [82910] (1 family) (S)
  5. 1465640Family g.61.1.1: Apical membrane antigen 1 [82911] (1 protein)
  6. 1465641Protein Apical membrane antigen 1 [82912] (1 species)
  7. 1465642Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [82913] (3 PDB entries)
  8. 1465644Domain d2j5la1: 2j5l A:479-512 [145662]
    Other proteins in same PDB: d2j5lb1, d2j5lb2, d2j5lc1, d2j5lc2

Details for d2j5la1

PDB Entry: 2j5l (more details), 2.9 Å

PDB Description: structure of a plasmodium falciparum apical membrane antigen 1-fab f8. 12.19 complex
PDB Compounds: (A:) apical membrane antigen 1

SCOPe Domain Sequences for d2j5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5la1 g.61.1.1 (A:479-512) Apical membrane antigen 1 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ifisddkdslkcpcdpemvsqstcrffvckcver

SCOPe Domain Coordinates for d2j5la1:

Click to download the PDB-style file with coordinates for d2j5la1.
(The format of our PDB-style files is described here.)

Timeline for d2j5la1: