Lineage for d2j57n_ (2j57 N:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639172Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2639173Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2639174Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2639231Protein automated matches [190303] (3 species)
    not a true protein
  7. 2639232Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries)
  8. 2639242Domain d2j57n_: 2j57 N: [145655]
    Other proteins in same PDB: d2j57a_, d2j57b_, d2j57c_, d2j57d_, d2j57g_, d2j57h_, d2j57i_, d2j57j_
    automated match to d1mg2b_
    complexed with cu

Details for d2j57n_

PDB Entry: 2j57 (more details), 2.25 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-quinol in complex with amicyanin.
PDB Compounds: (N:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2j57n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j57n_ g.21.1.1 (N:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d2j57n_:

Click to download the PDB-style file with coordinates for d2j57n_.
(The format of our PDB-style files is described here.)

Timeline for d2j57n_: