SCOPe 2.03: Domain d2j56l_: 2j56 L:

Lineage for d2j56l_ (2j56 L:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (2 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:266] [187112] (12 PDB entries)

8. Domain d2j56l_: 2j56 L: [145650]
   Other proteins in same PDB: d2j56a_, d2j56b_, d2j56h1, d2j56j1
   automated match to d1mg2b_
   complexed with cu, gol, na

Details for d2j56l_

PDB Entry: 2j56, 2.1 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-semiquinone in complex with amicyanin.

PDB Compounds: (L:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2j56l_:

Sequence; same for both SEQRES and ATOM records:

>d2j56l_ g.21.1.1 (L:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d2j56l_:

• d2j56l_ first appeared in SCOP 1.75, called d2j56l1
  
• d2j56l_ appears in SCOPe 2.02
  
• d2j56l_ appears in SCOPe 2.04
  
• d2j56l_ appears in the current release, SCOPe 2.08