![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
![]() | Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) ![]() |
![]() | Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
![]() | Protein automated matches [190303] (3 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries) |
![]() | Domain d2j55m_: 2j55 M: [145649] Other proteins in same PDB: d2j55a_, d2j55b_, d2j55h_, d2j55j_, d2j55l1 automated match to d1mg2b_ complexed with cu, gol |
PDB Entry: 2j55 (more details), 2.15 Å
SCOPe Domain Sequences for d2j55m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j55m_ g.21.1.1 (M:) automated matches {Paracoccus denitrificans [TaxId: 266]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d2j55m_: