Lineage for d2j55l1 (2j55 L:7-131)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891642Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 891643Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) (S)
  5. 891644Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)
  6. 891645Protein Methylamine dehydrogenase [57563] (2 species)
  7. 891650Species Paracoccus denitrificans [TaxId:266] [57564] (10 PDB entries)
  8. 891671Domain d2j55l1: 2j55 L:7-131 [145648]
    Other proteins in same PDB: d2j55a1, d2j55b1, d2j55h1, d2j55j1
    complexed with cu, gol, trq

Details for d2j55l1

PDB Entry: 2j55 (more details), 2.15 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase o-quinone in complex with amicyanin.
PDB Compounds: (L:) Methylamine dehydrogenase light chain

SCOP Domain Sequences for d2j55l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j55l1 g.21.1.1 (L:7-131) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOP Domain Coordinates for d2j55l1:

Click to download the PDB-style file with coordinates for d2j55l1.
(The format of our PDB-style files is described here.)

Timeline for d2j55l1: