Lineage for d2j3wf_ (2j3w F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009508Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 3009509Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. 3009560Family d.278.1.2: TRAPP components [118076] (3 proteins)
    Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold
  6. 3009566Protein TRAPPC5, similar to trafficking protein particle complex 5 [160687] (1 species)
  7. 3009567Species Zebrafish (Danio rerio) [TaxId:7955] [160688] (1 PDB entry)
    Uniprot Q6DGL5 21-188
  8. 3009569Domain d2j3wf_: 2j3w F: [145644]
    Other proteins in same PDB: d2j3wa_, d2j3wc_, d2j3wd_, d2j3we_
    automated match to d2j3wb1
    complexed with plm

Details for d2j3wf_

PDB Entry: 2j3w (more details), 2.1 Å

PDB Description: The crystal structure of the bet3-trs31-sedlin complex.
PDB Compounds: (F:) zgc 92866

SCOPe Domain Sequences for d2j3wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j3wf_ d.278.1.2 (F:) TRAPPC5, similar to trafficking protein particle complex 5 {Zebrafish (Danio rerio) [TaxId: 7955]}
tevsvsafallfsemvqycqsrvysvselqarladmgqgvgaslldvlvmrekngkretk
vlnillfikvnvwkalfgkeadkleqandddktyyiiekeplinayisvpkenstlncaa
ftggiveailthsgfpakvtvhwhkgttlmikfdesviardkaldgr

SCOPe Domain Coordinates for d2j3wf_:

Click to download the PDB-style file with coordinates for d2j3wf_.
(The format of our PDB-style files is described here.)

Timeline for d2j3wf_: