Lineage for d2j3wb1 (2j3w B:21-188)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615343Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 2615344Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. 2615395Family d.278.1.2: TRAPP components [118076] (3 proteins)
    Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold
  6. 2615401Protein TRAPPC5, similar to trafficking protein particle complex 5 [160687] (1 species)
  7. 2615402Species Zebrafish (Danio rerio) [TaxId:7955] [160688] (1 PDB entry)
    Uniprot Q6DGL5 21-188
  8. 2615403Domain d2j3wb1: 2j3w B:21-188 [145643]
    Other proteins in same PDB: d2j3wa_, d2j3wc_, d2j3wd_, d2j3we_
    complexed with plm

Details for d2j3wb1

PDB Entry: 2j3w (more details), 2.1 Å

PDB Description: The crystal structure of the bet3-trs31-sedlin complex.
PDB Compounds: (B:) zgc 92866

SCOPe Domain Sequences for d2j3wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j3wb1 d.278.1.2 (B:21-188) TRAPPC5, similar to trafficking protein particle complex 5 {Zebrafish (Danio rerio) [TaxId: 7955]}
ktevsvsafallfsemvqycqsrvysvselqarladmgqgvgaslldvlvmrekngkret
kvlnillfikvnvwkalfgkeadkleqandddktyyiiekeplinayisvpkenstlnca
aftggiveailthsgfpakvtvhwhkgttlmikfdesviardkaldgr

SCOPe Domain Coordinates for d2j3wb1:

Click to download the PDB-style file with coordinates for d2j3wb1.
(The format of our PDB-style files is described here.)

Timeline for d2j3wb1: