![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
![]() | Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) ![]() |
![]() | Family d.278.1.2: TRAPP components [118076] (3 proteins) Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold |
![]() | Protein TRAPPC5, similar to trafficking protein particle complex 5 [160687] (1 species) |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [160688] (1 PDB entry) Uniprot Q6DGL5 21-188 |
![]() | Domain d2j3wb1: 2j3w B:21-188 [145643] Other proteins in same PDB: d2j3wa_, d2j3wc_, d2j3wd_, d2j3we_ complexed with plm |
PDB Entry: 2j3w (more details), 2.1 Å
SCOPe Domain Sequences for d2j3wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j3wb1 d.278.1.2 (B:21-188) TRAPPC5, similar to trafficking protein particle complex 5 {Zebrafish (Danio rerio) [TaxId: 7955]} ktevsvsafallfsemvqycqsrvysvselqarladmgqgvgaslldvlvmrekngkret kvlnillfikvnvwkalfgkeadkleqandddktyyiiekeplinayisvpkenstlnca aftggiveailthsgfpakvtvhwhkgttlmikfdesviardkaldgr
Timeline for d2j3wb1: