Class a: All alpha proteins [46456] (289 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) automatically mapped to Pfam PF00453 |
Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
Protein Ribosomal protein L20 [74733] (4 species) |
Species Escherichia coli [TaxId:562] [158511] (29 PDB entries) Uniprot P0A7L3 1-117 |
Domain d2j28q1: 2j28 Q:1-117 [145637] Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1 automatically matched to 2AW4 Q:1-117 protein/RNA complex; complexed with mg |
PDB Entry: 2j28 (more details), 8 Å
SCOPe Domain Sequences for d2j28q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j28q1 a.144.2.1 (Q:1-117) Ribosomal protein L20 {Escherichia coli [TaxId: 562]} arvkrgviararhkkilkqakgyygarsrvyrvafqavikagqyayrdrrqrkrqfrqlw iarinaaarqngisyskfinglkkasveidrkiladiavfdkvaftalvekakaala
Timeline for d2j28q1:
View in 3D Domains from other chains: (mouse over for more information) d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1 |