Lineage for d2j28i2 (2j28 I:1-72)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190365Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2190366Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2190367Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2190371Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2190377Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2190404Domain d2j28i2: 2j28 I:1-72 [145632]
    Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1
    automatically matched to 2AW4 I:1-72
    protein/RNA complex; complexed with mg

Details for d2j28i2

PDB Entry: 2j28 (more details), 8 Å

PDB Description: model of e. coli srp bound to 70s rncs
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2j28i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j28i2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d2j28i2:

Click to download the PDB-style file with coordinates for d2j28i2.
(The format of our PDB-style files is described here.)

Timeline for d2j28i2: