SCOPe 2.07: Domain d2j28i1: 2j28 I:73-141

Lineage for d2j28i1 (2j28 I:73-141)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
   Uniprot P0A7J7 73-141

8. Domain d2j28i1: 2j28 I:73-141 [145631]
   Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1
   automatically matched to 2AW4 I:73-141
   protein/RNA complex; complexed with mg

Details for d2j28i1

PDB Entry: 2j28, 8 Å

PDB Description: model of e. coli srp bound to 70s rncs

PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2j28i1:

Sequence; same for both SEQRES and ATOM records:

>d2j28i1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

Timeline for d2j28i1:

• d2j28i1 first appeared in SCOP 1.75
  
• d2j28i1 appears in SCOPe 2.06
  
• d2j28i1 appears in the current release, SCOPe 2.08