![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) ![]() |
![]() | Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein) |
![]() | Protein Adenovirus fiber protein "knob" domain [49837] (7 species) |
![]() | Species Canine adenovirus 2 [TaxId:10514] [158981] (2 PDB entries) Uniprot Q65914 361-542 |
![]() | Domain d2j1km1: 2j1k M:361-542 [145617] Other proteins in same PDB: d2j1ka1, d2j1kb1, d2j1kg1, d2j1kj1, d2j1kk1, d2j1ko1, d2j1kp1, d2j1kt1, d2j1kv1, d2j1kx1, d2j1ky1, d2j1kz1 automatically matched to 2J1K C:361-542 |
PDB Entry: 2j1k (more details), 2.3 Å
SCOP Domain Sequences for d2j1km1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1km1 b.21.1.1 (M:361-542) Adenovirus fiber protein "knob" domain {Canine adenovirus 2 [TaxId: 10514]} apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge nq
Timeline for d2j1km1: