Lineage for d2j1kl_ (2j1k L:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943014Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 943015Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 943016Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
  6. 943057Protein automated matches [190333] (3 species)
    not a true protein
  7. 943058Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries)
  8. 943070Domain d2j1kl_: 2j1k L: [145616]
    Other proteins in same PDB: d2j1ka_, d2j1kb_, d2j1kc1, d2j1kg_, d2j1kj_, d2j1kk_, d2j1ko_, d2j1kp_, d2j1kt_, d2j1kv_, d2j1kx_, d2j1ky_, d2j1kz_
    automated match to d2j1kc1

Details for d2j1kl_

PDB Entry: 2j1k (more details), 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1
PDB Compounds: (L:) fiber protein

SCOPe Domain Sequences for d2j1kl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1kl_ b.21.1.1 (L:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq

SCOPe Domain Coordinates for d2j1kl_:

Click to download the PDB-style file with coordinates for d2j1kl_.
(The format of our PDB-style files is described here.)

Timeline for d2j1kl_: