Lineage for d2j1kf1 (2j1k F:361-542)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793517Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 793518Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) (S)
  5. 793519Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)
  6. 793520Protein Adenovirus fiber protein "knob" domain [49837] (7 species)
  7. 793521Species Canine adenovirus 2 [TaxId:10514] [158981] (2 PDB entries)
    Uniprot Q65914 361-542
  8. 793531Domain d2j1kf1: 2j1k F:361-542 [145613]
    Other proteins in same PDB: d2j1ka1, d2j1kb1, d2j1kg1, d2j1kj1, d2j1kk1, d2j1ko1, d2j1kp1, d2j1kt1, d2j1kv1, d2j1kx1, d2j1ky1, d2j1kz1
    automatically matched to 2J1K C:361-542

Details for d2j1kf1

PDB Entry: 2j1k (more details), 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1
PDB Compounds: (F:) fiber protein

SCOP Domain Sequences for d2j1kf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1kf1 b.21.1.1 (F:361-542) Adenovirus fiber protein "knob" domain {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq

SCOP Domain Coordinates for d2j1kf1:

Click to download the PDB-style file with coordinates for d2j1kf1.
(The format of our PDB-style files is described here.)

Timeline for d2j1kf1: