Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries) Uniprot Q72I15 2-102 |
Domain d2j03y1: 2j03 Y:2-102 [145608] Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03z1 protein/RNA complex protein/RNA complex |
PDB Entry: 2j03 (more details), 2.8 Å
SCOPe Domain Sequences for d2j03y1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j03y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc
Timeline for d2j03y1:
View in 3D Domains from other chains: (mouse over for more information) d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03z1 |