![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89815] (7 PDB entries) |
![]() | Domain d2j03x1: 2j03 X:3-95 [145607] Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03y1, d2j03z1 automatically matched to d1n88a_ complexed with lys |
PDB Entry: 2j03 (more details), 2.8 Å
SCOP Domain Sequences for d2j03x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j03x1 d.12.1.1 (X:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk kkrlgrylgkrpdrkkaivqvapgqkiealegl
Timeline for d2j03x1:
![]() Domains from other chains: (mouse over for more information) d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03y1, d2j03z1 |