| Class b: All beta proteins [48724] (178 folds) |
| Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) ![]() automatically mapped to Pfam PF00829 |
| Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
| Protein Ribosomal protein L21p [141093] (3 species) |
| Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries) Uniprot P60492 1-101 |
| Domain d2j03v1: 2j03 V:1-101 [145605] Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 protein/RNA complex protein/RNA complex |
PDB Entry: 2j03 (more details), 2.8 Å
SCOPe Domain Sequences for d2j03v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j03v1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
Timeline for d2j03v1:
View in 3DDomains from other chains: (mouse over for more information) d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 |