| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
| Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein) Pfam PF01245 |
| Protein Ribosomal protein L19 [141246] (3 species) |
| Species Thermus thermophilus [TaxId:274] [159030] (4 PDB entries) Uniprot P60490 1-138 |
| Domain d2j03t1: 2j03 T:1-138 [145603] Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 protein/RNA complex protein/RNA complex |
PDB Entry: 2j03 (more details), 2.8 Å
SCOPe Domain Sequences for d2j03t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j03t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]}
mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
idqdraaeraakeeaqka
Timeline for d2j03t1:
View in 3DDomains from other chains: (mouse over for more information) d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 |