Lineage for d2j03q1 (2j03 Q:6-141)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2189212Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2189277Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 2189278Protein Ribosomal protein L16p [117889] (4 species)
  7. 2189318Species Thermus thermophilus [TaxId:274] [160197] (5 PDB entries)
  8. 2189319Domain d2j03q1: 2j03 Q:6-141 [145600]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j03q1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (Q:) 50S ribosomal protein L16

SCOPe Domain Sequences for d2j03q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03q1 d.41.4.2 (Q:6-141) Ribosomal protein L16p {Thermus thermophilus [TaxId: 274]}
rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif
irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
piktkivrrdaydeaq

SCOPe Domain Coordinates for d2j03q1:

Click to download the PDB-style file with coordinates for d2j03q1.
(The format of our PDB-style files is described here.)

Timeline for d2j03q1: