Lineage for d2j03q1 (2j03 Q:6-141)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859091Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 859229Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 859294Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 859295Protein Ribosomal protein L16p [117889] (4 species)
  7. 859335Species Thermus thermophilus [TaxId:274] [160197] (5 PDB entries)
  8. 859337Domain d2j03q1: 2j03 Q:6-141 [145600]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    automatically matched to d1wkia_
    complexed with lys

Details for d2j03q1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (Q:) 50S ribosomal protein L16

SCOP Domain Sequences for d2j03q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03q1 d.41.4.2 (Q:6-141) Ribosomal protein L16p {Thermus thermophilus [TaxId: 274]}
rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif
irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
piktkivrrdaydeaq

SCOP Domain Coordinates for d2j03q1:

Click to download the PDB-style file with coordinates for d2j03q1.
(The format of our PDB-style files is described here.)

Timeline for d2j03q1: