SCOP 1.75: Domain d2j03p1: 2j03 P:5-150

Lineage for d2j03p1 (2j03 P:5-150)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (4 species)

7. Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries)
   Uniprot Q72I23 5-150

8. Domain d2j03p1: 2j03 P:5-150 [145599]
   Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
   automatically matched to 2J01 P:5-150
   complexed with lys

Details for d2j03p1

PDB Entry: 2j03, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (P:) 50S ribosomal protein L15

SCOP Domain Sequences for d2j03p1:

Sequence; same for both SEQRES and ATOM records:

>d2j03p1 c.12.1.1 (P:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]}
dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
vvahafsksaleklkaaggepvllea

Timeline for d2j03p1:

• d2j03p1 is new in SCOP 1.75
  
• d2j03p1 appears in SCOPe 2.01
  
• d2j03p1 appears in the current release, SCOPe 2.08