Lineage for d2j03n1 (2j03 N:1-139)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825308Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 825309Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 825310Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 825311Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 825396Species Thermus thermophilus [TaxId:274] [159473] (10 PDB entries)
    Uniprot P60488 1-139
  8. 825398Domain d2j03n1: 2j03 N:1-139 [145598]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    automatically matched to 2J01 N:1-139
    complexed with lys

Details for d2j03n1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (N:) 50S ribosomal protein L13

SCOP Domain Sequences for d2j03n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03n1 c.21.1.1 (N:1-139) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
kvyagpdhphqaqrpekle

SCOP Domain Coordinates for d2j03n1:

Click to download the PDB-style file with coordinates for d2j03n1.
(The format of our PDB-style files is described here.)

Timeline for d2j03n1: