Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) automatically mapped to Pfam PF00297 |
Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
Species Thermus thermophilus [TaxId:274] [159158] (11 PDB entries) Uniprot Q72I04 1-205 |
Domain d2j03e1: 2j03 E:1-205 [145593] Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 automatically matched to 2J01 E:1-205 protein/RNA complex |
PDB Entry: 2j03 (more details), 2.8 Å
SCOPe Domain Sequences for d2j03e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j03e1 b.43.3.2 (E:1-205) Ribosomal protein L3 {Thermus thermophilus [TaxId: 274]} mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen lllvkgavpgpngglvivretkkaa
Timeline for d2j03e1:
View in 3D Domains from other chains: (mouse over for more information) d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 |